Trend desain rumah industrial terus menanjak, baik untuk penggunaan rumah/residensial hingga untuk kafe atau bisnis. Supaya tidak salah pengertian, yuk cek dulu apa itu rumah desain industrial berikut pro dan kontra dari konsep interior yang menarik ini.
Apa itu Desain Rumah Industrial?
Desain rumah industrial mengacu pada konsep yang to-the-point alias bebas ribet. Inspirasi dari sebuah rumah industrial juga erat pada gaya mentah seperti yang sering terlihat di pabrik, pergudangan atau struktur industri lainnya. Detail pada rumah industrial sering menggunakan bahan batu bata, metal atau material daur ulang lainnya dalam aspek arsitekturnya.
Dari segi dekorasi atau furnitur, rumah industrial tetap bisa menggabungkan antara elemen yang berkesan tua dengan yang baru. Tetap ada benang merah utama yaitu kesan modern yang unik dan nyaman pada akhir desain rumah industrial.
Saat mendesain rumah industrial, berikut adalah karakteristik yang harus hadir supaya style ini terasa maksimal dan efektif :
Material
Untuk bahan rumah industrial, kalian akan jarang menemukan bahan mewah seperti kain sutra atau berudu. Bahan yang hadir umumnya punya sifat tangguh, tahan pakai dan punya daya daur ulang yang fungsional. Furnitur antik dari bahan kayu, aluminium, batu dsbnya sering menjadi pilihan utama, terutama jika ada kesan distressed atau usang.
Warna
Untuk desain rumah industrial, palet warna akan didominasi dengan nuansa netral, misalnya abu, hitam dan putih. Sesekali ada gradasi warna yang kelam dan maskulin, tetapi kalian tetap boleh menghadirkan warna terang yang kontras supaya hasil akhirnya tampil indah - misalnya melalui lukisan atau karya seni.
Siluet
Garis lurus dan struktur tegas sering menjadi ciri khas bentuk desain rumah industrial. Namun bukan berarti rumah industrial tidak boleh menghadirkan kurva indah atau pola abstrak. Yang penting, aplikasinya harus tepat dan tidak berlebihan.
Dekorasi
Penggunaan aksesoris atau dekorasi termasuk jarang di desain rumah industrial, karena ada tema minimalis yang bersih dan rapi yang harus dipertahankan. Elemen dekor jumlahnya minimal tetapi atraktif dan sukses mencuri perhatian.
Kelebihan dan Kekurangan Desain Rumah Industrial
Banyak yang menggemari desain rumah industrial karena beberapa kelebihan berikut :
Cukup terjangkau, karena jauh dari kesan mewah yang serba elegan. Perabot daur ulang dan elemen desain low-budget lainnya bisa diterapkan di desain rumah industrial. Penggunaan dekorasi juga tidak berlebihan, sehingga kian menghemat pengeluaran.
Penuh karakter dan unik. Kontras antara modern dan usang bersanding secara harmonis menjadikan desain rumah industrial hadir lain daripada yang lain.
Ramah lingkungan, karena pendekatan yang menggunakan bahan daur ulang, minim cat, dan tidak selalu membutuhkan sistem perapian yang boros bahan dan tenaga.
Leluasa dan nyaman. Desain rumah industrial menekankan pada ruang dan kesan adem yang bikin betah.
Sedangkan dari segi kekurangan pada desain industrial antara lain tantangan menghadirkan kesan berkelas bermodalkan bahan- bahan yang berkesan usang. Sering kali, aransemen yang salah malah membuat rumah terlihat murahan. Selain itu, idealnya, rumah industrial membutuhkan space yang lebih luas supaya tidak terkesan kaku.
Konsistensi adalah kunci saat menghadapi tantangan pada desain rumah industrial, sehingga seorang desainer harus ekstra hati- hati dalam perencanaan hingga eksekusi final. Pencarian bahan dan dekorasi juga mungkin lebih sulit, tetapi tentunya hasilnya juga akan sangat memuaskan bila ditekuni hingga tuntas.
rising in continental Europe at the start of the twentieth century, phenomenology is a way of understanding that emphasizes the description and interpretation of human experience, awareness, and meaning, particularly their unnoticed, taken-for-granted
A
dimensions (Moran 2000; van Manen 2014). The German philosopher Edmund Husserl (1859–
1938) was the founder of phenomenology, which he envisioned as “the descriptive, non- reductive science of whatever appears, in the manner of its appearing, in the subjective and intersubjective life of consciousness” (Moran 2005: 2). Over time, other European philosophers, including Martin Heidegger (1889–1976) and Maurice Merleau-Ponty (1908–1961), shifted their phenomenological explications beyond “consciousness” toward related philosophical topics such as the nature of human being, the various modes experientially by which human meaning arises, and the central role of bodily presence and action in human life. Examples of questions relevant to architecture that might be explored phenomenologically include the following:
▪ In what ways does architecture nurture or disrupt human life, whether via everyday, ordinary experience or via intense, extra-ordinary encounter?
▪ How do qualities of the designable world—materiality, spatiality, tectonics, aesthetic qualities, and so forth—contribute to human well-being and aesthetic sensibilities?
▪ How does the design of a particular building play a role in sustaining or undermining the
lives, actions, and needs of that building’s users?
▪ Have the everyday uses, experiences, and meanings of specific buildings and building types (e.g., places of residence, work, education, worship, incarceration, and so forth) changed over historical time? How are those uses, experiences, and meanings alike or unlike for different places, cultures, lifeways, social groups, and historical eras?
▪ What impact do advances in digital technology and virtual reality have on the lived nature of architecture and real-world places?
▪ If virtual reality is eventually able to simulate “real” reality entirely, will this shift
radically transform the lived nature of places, buildings, and everyday human life?
In this chapter, I encapsulate the complex, shifting relationship between phenomenology and architecture by speaking of an architectural phenomenology, which I tentatively define as the
descriptive and interpretive explication of architectural experiences, situations, and meanings as constituted by qualities and features of both the built environment and human life (Otero-Pailos
2012; Seamon 2017). In demonstrating that architectural phenomenology has significant research and design value today, I first describe the phenomenological approach more fully, highlighting two key phenomenological concepts relevant for architectural understanding—lifeworld and natural attitude. Second, I overview the thread of theoretical and practical events whereby architects and architectural thinkers became interested in phenomenology. Third, I discuss two phenomenological topics that have come to have value for architecture and architectural theory: (1) lived embodiment; and (2) architectural atmospheres. Last, I suggest what value phenomenology might have for the future of architecture, particularly in regard to the imminent arrival of virtual reality, virtual places, and virtual buildings.
The Nature of Phenomenology
The phenomenologist’s primary aim is to strive for a mode of openness whereby the phenomenon studied can be understood and described in an accurate, comprehensive way unencumbered by any pre-given theoretical, speculative, or common-sense points of view. One of Husserl’s descriptions of phenomenology was “back to the things themselves,” by which he meant setting aside personal, societal, ideological, and conceptual understandings, assumptions, and prejudices so that one might offer the phenomenon a supportive venue in which it can be known most clearly, appropriately, and thoroughly (Moran 2005: 9–17).
Most broadly, phenomenologists direct this mode of openness toward generating clear-sighted explications of concrete human experience and the lived reality of everyday life. Using the word “lived” in phrases like “lived reality” or “lived experience” may seem tautological, since, obviously, experience is always lived. For phenomenologists, however, “lived” is an integral descriptor because it “announces the intent to explore directly the originary or prereflective dimensions of human existence: life as we live it” (van Manen 2014: 28). “Lived” in this sense refers to the wide-ranging spectrum of human experiences, meanings, situations, and events—the mundane or exotic, the dull or penetrating, the unquestioned or surprising. How, for example, do we experience the everyday buildings of our ordinary lives and are there moments when we experience those buildings in a deeper, more memorable way (Pallasmaa 2005)? What delineates experientially the special moment when we encounter a great architectural work, and might such exhilarating moments of architectural engagement be better understood by drawing on phenomenological principles and methods (Bermudez 2015)?
Phenomenologists claim that human consciousness, experience, and action are always intentional—i.e., necessarily oriented toward and finding their significance in a world of emergent meaning. Human beings are not just aware but aware of something, whether an object, living thing, idea, feeling, environmental situation, or the like.. As described by Merleau-Ponty (1962: xvii), the distinguishing feature of intentionality is that “the unity of the world, before being posited by knowledge in a specific act of identification, is ‘lived’ as ready-made or already there.” The concept of intentionality leads to a central phenomenological claim crucial for
understanding human experience: that human beings are always already inescapably immersed and entwined in their worlds (Casey 2009; Moran 2011; van Manen 2014). How, phenomenologically, do we describe the way in which, existentially, selves and world are reciprocally related and mutually dependent? How, phenomenologically, do we locate and understand the complex, multivalent ways in which we, as human beings, are intertwined, intermeshed, entrenched and submerged in the worlds in which we find ourselves?
The everyday, intentional structure through which human-immersion-in-world unfolds is what Husserl identified as the lifeworld—a person or group’s day-to-day world of taken-for- grantedness normally unnoticed and, therefore, concealed as a phenomenon: “As conscious beings, we always inhabit—in a pre-theoretical manner—an experiential world, given in advance, on hand, and always experienced as a unity” (Moran 2005: 9). One aim of phenomenological study is to identify and describe the various lived structures and dynamics of the lifeworld, which always includes spatial, environmental, and place dimensions. Unless it shifts in some unusual way, we are almost always, in our typical human lives, unaware of our lifeworld, which we assume is the only way that life can be. This typically unquestioned acceptance of the lifeworld is what Husserl called the natural attitude, a mode of awareness “that obscures itself and remains unknown to itself. It is an attitude with blinkers on, as Husserl often said” (Moran 2011: 69). Because of the natural attitude, any lifeworld is transparent in the sense
that it is normally tacit and just happens, grounded in spatial-temporal situations and events more or less regular (Moran 2005: 9–17; 2011; van Manen 2014).
In applying the concept of lifeworld to architecture, one realizes that there are the individual lifeworlds of all users associated with a building as, at the same time, there is the more complex lifeworld of the building itself generated by those individual lifeworlds. The lived dynamic and character of the building’s lifeworld may support or interfere with the individual lifeworlds housed within that the building (Seamon 2017). Later in this chapter, I make further reference to architectural aspects of lifeworlds, but first I delineate how, beginning after World War II, phenomenology came to have significance for architects and architectural thinking.
The Development of Architectural Phenomenology
The progressive influence of phenomenology in architecture is a complex narrative involving several different disciplines, professional efforts, and intellectual events. Beginning in the 1940s, philosophers working phenomenologically explored a wide range of themes implicitly relevant
to architecture. Merleau-Ponty (1945/1962) demonstrated how the lived body plays a key role in human spatiality (Hale 2017; McCann and Locke 2015), and Heidegger (1952/1971) contended that human-being-in-the-world is always human-being-grounded-in-place, especially as that place sustains and is sustained by engaged caretaking—what Heidegger identified as dwelling
(Sharr 2007; Malpas 2006; Mugerauer 2008). Other thinkers produced phenomenological studies that incorporated architectural topics directly. In Poetics of Space, philosopher Gaston Bachelard (1957/1964: 8) delineated a research focus he called topoanalysis,” the systematic psychological study of the sites of our intimate lives.” In Sacred and the Profane, phenomenologist of religion
Mircea Eliade (1957/1961) examined hierophany, the lived ways that spiritual reality can break through into lifeworlds, including through place and architecture. In Human Space, phenomenological philosopher Otto Bollnow (1963/2011) developed a phenomenology of space as experienced, including the lived dialectic between “the wide world” and “the security of the house.”
In the late1940s and 1950s, architects became interested in phenomenology directly. In his book- length historiography of architectural phenomenology during this post-war period, architectural theorist Jorge Otero-Pailos (2010) highlighted several key figures, beginning with the Italian modernist architect Ernesto Nathan Rogers (1909–1969), who promoted “some of the earliest contacts between architects and phenomenologists” and gathered around himself “a small but influential group of young European architects… who explored phenomenology as an
intellectual framework for rethinking modernism” (2010: xxiv). Another key figure discussed by Otero-Pailos is the French-American architect Jean Labatut (1899–1986), who saw phenomenology as a conceptual tool for envisioning innovative designs arising from and aiming to enhance human experience (2010: 35–40). For example, Labatut designed a series of architectural and environmental works that generated a sense of participatory exhilaration and architectural sacredness through visual, acoustic, and tactile encounter. One such effort was Labatut’s “Lagoon of Nations,” a 1,400-nozzle fountain designed to create a nightly spectacle for the 1939 New York World’s Fair (2010: 40–57).
As founder of the first American Architecture doctoral program at Princeton in 1949, Labatut played a critical role in promoting architectural phenomenology academically (2010: 95-99). One of the most influential doctoral students under his direction was American architect Charles Moore (1925–1993), who completed in 1957 one of Princeton’s first Architecture dissertations, which focused on a Gaston-Bachelard-inspired “Water and Architecture.” Frustrated that, at the time, architectural scholarship was largely controlled by architectural historians, Moore (and
Bloomer 1977) worked “to legitimatize a notion of intellectuality based on different standards of competency, including visual proficiency and the ability to grasp the historical essence of buildings experientially” (2010: 100).
In the transformational 1960s, academic and professional interest in architectural phenomenology continued, partly via the development of “environment-behavior studies” (“EBS”), an interdisciplinary research and design field that became an important component of many American, Canadian, and British architecture programs in the 1970s and early 1980s (Sachs 2013). Identified variously as “architectural psychology,” “behavioral geography,” “environmental psychology,” or “human factors in design,” this movement was driven by the work of such innovative thinkers as architects Christopher Alexander (1964), Kevin Lynch (1960), and Oscar Newman (1973); anthropologist Edward Hall (1966); psychologist Robert Sommer (1969/2007); and urbanists Jan Gehl (1987), Jane Jacobs (1961) and William Whyte (1980). Though much of the EBS research was positivist, quantitative, and limited to the cognitive dimensions of architectural and environmental behavior, thinkers like Alexander (et al.
1977) and Jacobs (1961) produced work that was qualitative, interpretive, and implicitly phenomenological. Also appearing during this time were the writings of so-called “humanistic geographers” like Edward Relph (1976) and Yi-Fu Tuan (1974). Strongly influenced by EBS but drawing directly on phenomenological concepts like place, rootedness, dwelling, and placelessness, these geographers provided one academic reference point for later phenomenological efforts examining architectural embodiment, environmental atmospheres, and architectural design as it might facilitate place and place making (Casey 2009; Malpas 1999; Mugerauer 1994; Shatzki 2007).
One important architectural theorist considerably influenced by EBS was the Norwegian
Christian Norberg-Schulz (1926–2000), who, during the 1970s and 1980s, played a crucial role
in keeping phenomenology in sight for architects. Like Rogers and Labatut before him, Norberg- Schulz sought to re-conceptualize how architects understood architecture, partly through phenomenological reformulations of the work of EBS researchers like Kevin Lynch and Edward Hall. Norberg-Schulz aimed for “a return to the roots of modernism by visualizing the self- renewing origin of architecture,” which he located in foundational lifeworld patterns and structures such as lived-space, home, at-homeness, and environmental ambience (Otero-Pailos
2010: 146). In his first major phenomenological work, Existence, Space and Architecture (Norberg-Schulz 1971: 14, 37), he contended that a comprehensive architectural understanding requires “a theory where space is really understood as a dimension of human existence…” Architectural space, therefore, is best envisioned as “a “concretization” of existential space.” In his many later books and articles, he explored the architectural and environmental dimensions of human “lived space,” including place (Norberg-Schultz 1988, 2000a), dwelling (Norberg-Schulz
1985), and sense of place and genius loci (Norberg-Schulz 1980).
Particularly because of Norberg-Schulz’s work, architectural interest in phenomenology continued through the 1990s into the 2000s, though the perspective began to be challenged in the
1980s by newer conceptual approaches, including poststructuralism, deconstruction, and feminist and critical points of view (Mugerauer 1994; Otero-Pailos 2010, 2012; Parella 1988). Although these and other “cutting-edge” perspectives have come to dominate architectural theory today, consequential phenomenological work continues to appear, including the writings of
In describing architectural phenomenology as it is practiced today, architectural theorists John Macarthur and Naomi Stead (2012: 127) wrote that the approach “proposes to explain directly how the spaces we inhabit make us feel.” Otero-Pailos (2012: 136) extended this understanding when he defined architectural phenomenology as “the study of architecture as it presents itself to consciousness in terms of so-called archetypal human experiences, such as the bodily orientation of up and down, the perceptions of light and shadow, or the feelings of dryness and wetness.” Highlighting the perceptual, sensuous, and affective aspects of buildings and architectural experience, these two definitions of architectural phenomenology are a useful starting point, though it is important to recognize that phenomenological research can probe other relevant dimensions of architectural experience. For example, other recent phenomenological studies
have examined such topics as environmental wholeness (Alexander et al. 1977); pre-reflective and symbolic languages of architectural experience and meaning (Alexander 2002–2005; Harries
1997; Janson and Tigges 2014); and the phenomenological contribution to cognitive science, particularly in relation to architectural behaviors, aesthetic sensibility, and environmental wayfinding (Hale 2017: 50–54; Mallgrave 2013; Mallgrave and Goodman 2011: 229–230; Robinson and Pallasmaa 2015).
In short, phenomenology continues to be an important conceptual and practical force in contemporary architecture and architectural theory. To illustrate this claim, I highlight two phenomenological topics often drawn upon in architectural thinking today—environmental embodiment and architectural atmospheres.
Environmental Embodiment and Architecture
Environmental embodiment refers to the lived body in its unself-conscious perceptual awareness as it encounters and coordinates with the world at hand, especially its environmental and architectural aspects (Casey 2009; Pallasmaa 2005, 2009; McCann and Locke 2015; Mallgrave
2013). Merleau-Ponty (1945/1962) contended that the taken-for-granted foundation of human experience is perception, which he interpreted as the typically unnoticed, immediate givenness of the world undergirded by a lived body that is conscious of, acting in, and experiencing a world that automatically reciprocates with familiar pattern, meaning, and contextual presence. Merleau- Ponty argued that perception incorporates a lived dynamic between the body and world such that aspects of the world are understood because they instantaneously evoke in the lived body their corresponding experienced qualities. For example, one “sees the springiness of steel” or “hear[s] the hardness and unevenness of cobbles in the rattle of a carriage” (1945/1962: 229, 230). Through bodily perception, we immediately engage with and are aware of the world because it immediately engages with us to offer a reciprocating, pre-reflective sensibility and signification.
In the last several years, there has appeared an expanding body of studies considering what Merleau-Ponty’s understanding of perception might mean for architectural thinking and design (Hale 2017; McCann and Locke 2015; Rush 2008). Central here is the work of Finnish architectural theorist Juhani Pallasmaa (2005, 2009), who drew partly on Merleau-Ponty to argue that much contemporary architectural design is dominated by sight with the result that buildings
may be striking visually but have largely lost any expression of plasticity and multivalent sensuousness. For Pallasmaa (2005: 71), architects must aim to “create embodied and lived existential metaphors that concretise and structure our being in the world.” He argued that “Significant architecture makes us experience ourselves as complete embodied and spiritual beings” (2005: 11). He found examples of such rich, afferent design in the buildings of architects like Alvar Aalto, Glenn Murcutt, Steven Holl, and Peter Zumthor (2005: 70–71).
More recently, Pallasmaa (2009) examined the relationship between the lived body and the process of architectural design. He contended that architectural education today places too much emphasis on cerebral and verbal knowledge at the expense of embodied processes, particularly the importance of the hand in envisioning and actualizing design possibilities:
Architecture is… a product of the knowing hand. The hand grasps the physicality and materiality of thought and turns it into a concrete image. In the arduous processes of designing, the hand often takes the lead in probing for a vision, a vague inkling that it eventually turns into a sketch, a materialization of an idea (2009: 16–17).
To argue for the continuing importance of the hand in architectural design and fabrication, Pallasmaa reviewed the lived quality of craft and the importance of manual tactility in architectural drawing whereby the hand is in a “direct and delicate collaboration and interplay with mental imagery. It is impossible to know which appeared first, the line on the paper or the thought… (2009: 91). In this sense, the process of drawing is a “pulling out” in which the hand “feels the invisible and formless stimulus, pulls it into the world of space and matter, and gives it shape” (2009: 92). Pallasmaa contrasted this embodied way of designing with architecture’s current emphasis on digital technology, which differs from previous design instruments because it largely unfolds in an abstract, mathematized space that bypasses the “direct haptic connection
between the object, its representation, and the designer’s mind” (2009: 95–96). Pallasmaa argued that computer-aided design is a valuable architectural tool but should not be introduced in design education until students have first mastered hand drawing and physical-model making: “[T]he computer probably cannot do much harm after the student has learned to use his or her imagination and has internalised the crucial process of embodying a design task” (2009: 99).
Environmental Embodiment, Body-Subject, and Place
Merleau-Ponty also demonstrated that, besides its more passive perceptual dimension, the lived body incorporates a more active, motor dimension of perception—what he termed body-subject, or pre-reflective corporeal engagement expressed via action and typically in sync with the spatial and physical environment in which the action unfolds (Merleau-Ponty 1945/1962). Emphasizing that everyday, taken-for-granted actions and behaviors are grounded bodily rather than cognitively, Merleau-Ponty (1945/1962: 138–139) wrote that “Motility… is not a handmaid of [cognitive] consciousness, transporting the body to that point in space of which we have formed
a representation beforehand. In order that we may be able to move our body towards an object, the object must first exists for it, our body must not belong to the realm of the ‘in-itself’.”
Integrally related to the lived body, body-subject, and environmental embodiment is the phenomenological concept of place, which can be defined as any environmental locus that draws human experiences, actions, and meanings together spatially and temporally (Casey 2009, Malpas 1999, Relph 1976, Seamon 2013). In discussing the lived relationship between place and environmental embodiment, the phenomenological philosopher Edward Casey emphasized that “lived bodies belong to places and help to constitute them” just as, simultaneously, “places
belong to lived bodies and depend on them” (Casey 2009: 327). Through corporeal actions and encounters, individuals contribute to the constitution of a place as, at the same time, those actions and encounters contribute to the person or group’s sense of lived involvement and identification with that place. In short, lived bodies and places “interanimate each other” (2009: 327). This interanimation of lived bodies and places is significant because the habitual, unself-conscious familiarity of body-subject is one way by which individuals and groups actualize a taken-for- granted involvement with place.
Drawing on the concepts of environmental embodiment and place-body interanimation, phenomenological researchers have considered the spatial and environmental versatility of the lived body as expressed in more complex corporeal ensembles extending over time and space and contributing to a wider lived geography (Casey 2009; Jacobson 2010: 223). One such ensemble is body routines—sets of integrated gestures, behaviors, and actions that sustain a particular task or aim, for example, preparing a meal, mastering the use of carpentry tools,
building a stone wall, and so forth. Another such bodily ensemble is time-space routines—sets of more or less habitual bodily actions extending through a considerable portion of time, for example, a getting-ready-for-work routine, or a Sunday-afternoon-going-to-the-park routine (Seamon 2013).
Particularly pertinent to architectural design is the possibility that, in a supportive spatial and physical environment, individuals’ bodily routines converge and commingle in time and space, thereby contributing to a larger-scale environmental ensemble identified as place ballet—an interaction of individual bodily routines rooted in a particular environment, which often becomes an important place of interpersonal and communal exchange, meaning, and attachment such as a well-used office lounge, a vibrant city plaza, or an exuberant urban neighborhood (Jacobs 1961; Oldenburg 1999). A major phenomenological question is how environmental design might generate thriving place ballets, whether at architectural or wider environmental scales (Alexander et al. 1977; Jacobs 1961; Seamon 2013).
feelings and the tacit emotional tone of environments, spaces, or places. Gernot Böhme (2014:
43, 56), for example, explained that atmospheres involve “a spatial sense of ambience” and the “total impression that is regarded as characteristic” of an environment or place. Tonino Griffero (2014: 37) defined atmospheres as “spatialized feelings” and “the specific emotional quality of a given ‘lived space’.” One important lived aspect of atmosphere is its ambivalent, liminal quality: it belongs to neither the experiencer nor the situation experienced; it varies in its lived intensity, for different experiencers in the same moments and for the same experiencer in different moments. As Böhme (1993: 122) explained:
[A]tmospheres are neither something objective, that is, qualities possessed by things, and yet they are something thinglike, belonging to the thing in that things articulate their presence through qualities…. Nor are atmospheres something subjective, for example, determinations of a psychic state. And yet they are subjectlike [and] belong to subjects in that they are sensed in bodily presence by human beings, and this sensing is at the same time a bodily state of being of subjects in space.
(2016: 21, 24) contended that “good architecture should be primarily concerned with creating the moods appropriate to positive emotions that support ethical human action….” In asking why some buildings seem more pleasurable, enticing, or comfortable than others, Peter Zumthor (2006: 13) argued that one defining feature is atmosphere: “I enter a building, see a room and— in a fraction of a second—have this feeling about it.” Zumthor (2006: 10, 19) described atmosphere as “a beautiful natural presence” and the “magic of things, the magic of the real
world.” Juhani Pallasmaa (2014: 20) defined atmosphere as “the overarching perceptual, sensory, and emotive impression of a space, setting, or social situation. It provides the unifying coherence and character for a room, space, place, and landscape….” In proposing that all buildings,
whether prosaic or monumental, project some degree of ambience and mood, Pallasmaa (2016:
132–133) went so far as to suggest that atmosphere, rather than visible building form, is usually the most important dimension of architectural experience for non-architects and the lay public: “All buildings, monumental or commonplace, ritual or utilitarian, create atmospheres through which we experience the world and ourselves. This unconscious orientation and articulation of mood is often the most significant effect of a space or a building. I believe that non-architects sense primarily the atmosphere of a place or building, whereas attention to visible form implies a distinct intellectual and theoretical position.”
Atmosphere, Natural Symbols, and Architectural Archetypes
If architectural atmosphere is as important as Pallasmaa claimed, then two provocative questions arise, the first of which is whether there are heuristic means whereby one might become more
sensitive to the ineffable qualities of architectural atmosphere. Can we, asked Pallasmaa (2014:
29) generate “a deepened sense of materiality, gravity, and reality?” A second related question is whether architectural atmospheres can be created directly? Can architects and other responsible parties “bring about the conditions in which atmospheres of a particular character are able to develop” (Böhme 2014: 58)?
In answering these two questions, the phenomenological work of philosopher Karsten Harries (1988, 1997) and architectural theorist Thomas Thiis-Evensen (1989) offers helpful guidance. Focusing on the visceral, pre-reflective, bodily aspects of environmental experience and meaning, both thinkers developed revealing conceptual languages for becoming more alert to architectural atmospheres. Harries proposed a “natural language of space” (Harries 1997: 125) that draws on natural symbols—normally taken-for-granted, experiential qualities integrally associated with essential qualities of human nature and life, for example, lived qualities of materiality, of weight, of light, of temperature, of direction, of sociability, of privacy, and so forth. Harries suggested that the experiential structure of any natural symbol incorporates some manner of lived binary—for example, experiences of moving or resting, lying down or standing up, sensing lightness or heaviness, or feeling inside or outside. In his work, he explored such natural symbols as vertical and horizontal, up and down, light and darkness, and down, and inside and outside.
One example is Harries’ explication of how the lived binary between verticality and horizontality arises from the upright human body’s postural uprightness as it exists in lived relationship with the earth’s horizontal plane (Harries 1988: 40–45; 1997: 180–192). There is the vertical’s anchoring power of dwelling and rootedness existing in tension with the mobility and the horizon’s lure of open spaces. There is the vertical’s skyward movement toward sacredness and spiritual presence, which contrasts with the horizon’s expression of material extension and worldly success. Different cultures, historical eras, and architectural styles express the vertical- horizontal tension in a wide range of ways but, whatever the particular manifestation, it “presupposes an understanding of the meaning of verticals and horizontals inseparable from our being in the world” (Harries 1988: 45).
As an interpretive means for pondering Harries’ natural symbols as they might be actualized in specific buildings, one useful guide is Norwegian architect Thomas Thiis-Evensen’s Archetypes in Architecture, a phenomenology of architectural experience as encountered through the lived body and originally his doctoral dissertation done under the direction of Norberg-Schulz (Thiis- Evensen 1989). Thiis-Evensen’s aim is to understand “the universality of architectural expression”; his interpretive means is what he called architectural archetypes—“the most basic elements of architecture,” which he identified as floor, wall, and roof (1989: 8). He argued that the lived commonality of floor, wall, and roof is their making an inside in the midst of an outside, though in different ways: the floor, through above and beneath; the wall, through within and around; and the roof, through over and under.
Thiis-Evensen proposed that a building’s relative degree of insideness and outsideness in relation to floor, wall, and roof can be clarified through what he called the three “existential expressions” of architecture: motion, weight, and substance (1989: 21). Motion refers to an architectural element’s lived sense of dynamism or inertia—i.e., whether the element seems to expand, to contract, or to rest in balance. In turn, weight refers to the element’s lived sense of heaviness or lightness, and substance involves the element’s lived sense of material expression—whether it seems hard or soft, fine or coarse, cold or warm, and so forth. Using examples from architectural history as descriptive evidence, Thiis-Evensen generated an intricate lived language arising from and describing the corporeal and sensory dimensions of architectural experience and meaning.
For example, he discussed stairs as one kind of directed floor and explored how a stairs’ material and spatial qualities of slope, breadth, form, and relative connectedness to the ground contribute to varying sensuous and bodily experiences of motion, weight, and substance (1989: 89–113). Thiis-Evensen’s architectural interpretation offers one inventive heuristic means for detailing the tacit, pre-predicative perceptual relationship between experiencers and the built world (Seamon
2017).
Both Harries’ natural symbols and Thiis-Evensen’s architectural archetypes provide perceptive architectural languages that offer discerning interpretive means to locate and understand less effable, unself-conscious, haptic qualities that contribute to a building’s architectural atmosphere. In turn, an awareness of these normally tacit, taken-for-granted architectural qualities might help architects better to envision an appropriate “fit” between what a building
needs to be lifeworld-wise and what it might be as a field of ambient presence. As this discussion of architectural atmosphere indicates, a large portion of architectural experience is pre-cognitive, corporeal, and hidden from conscious awareness. In this sense, the insightful languages of
Harries and Thiis-Evensen bring direct intellectual attention to architectural qualities and situations that are otherwise unspoken and concealed in the natural attitude of architectural experiences and meanings.
Architecture, Architectural Phenomenology, and Virtual Worlds
For the future of architecture, the question of virtual worlds becomes increasingly pressing, both theoretically and practically. If virtual places, including virtual buildings, come to be experienced as “real” as their real-world counterparts, does this development mean the eventual demise of many “real” places and “real “buildings as we currently know them? On one hand, there is the optimistic argument that virtuality can extend real reality and improve and amplify the real world in ways impossible before its availability. In envisioning long-term trends that he claimed will revolutionize human life in the next thirty years, futurist Kevin Kelly (2016: 216) included virtual reality and suggested that, within a decade, virtual-reality displays will be so “real” that users will think they are “looking through a real window into a real world. It’ll be
bright—no flicker, no visible pixels. You will feel this is absolutely for sure real. Except it isn’t.” Kelly (2016: 229) contended that, in three decades, virtual reality will be as commonplace as cell phones and used to play “virtual sports,” perform in “virtual plays,” and visit “virtual places” and “virtual historic sites” that are so “real” that the user entirely forgets that they are not:
Cheap abundant VR will be an experience factory. We’ll use it to visit environments too dangerous to risk in the flesh, such as war zones, deep seas, or volcanoes. Or we’ll use it for experiences we can’t readily get to as humans—to visit the inside of a stomach, the surface of a comet…. Or to cheaply experience something expensive, like a flyby of the Himalayas.
On the other hand, there is the less sanguine argument that virtual reality too readily fabricates experiences that might seem real but could never fully happen in actual lifeworlds. For example, phenomenological philosopher Albert Borgmann (1992: 87–102) identified several lived qualities via which virtual reality facilitates distortions, reductions, or embellishments of real reality when recast virtually. One such embellishing quality is pliability, the ways that virtual reality can generate virtual objects and experiences impossible to be had in real reality (for example, the virtual ability to fabricate, reshape, or destroy virtual buildings and places at will). Borgmann also highlighted brilliance, the facility of virtual reality to highlight and enhance an experience’s attractive features and de-emphasize or eliminate any uninteresting, unpleasant, or irrelevant dimensions (for example, virtual places that are always “picture perfect” and never deteriorate, become soiled, or expose untoward or unkind aspects of human life).
Borgmann (1992: 96) pointed out that, underlying these lived aspects of virtual reality is the more basic existential principle that the real world “encumbers and confines.” Though virtual reality may superficially seem real, it can readily escape from and replace the lived messiness of real lifeworlds with more convenient, vivid, or fantastical situations that require no stakes, answerability, or efforts of will. On one hand, virtual reality holds extraordinary promise in that
it may become a welcome means for repairing a good number of the world’s problems. Who, for example, needs an automobile if she can simply put on her virtual headset and “go to” her virtual workplace, grocery store, or favorite recreation place? Who needs a real house, place of worship, or vacation destination if all these “places” and “experiences” might be produced virtually? On the other hand, virtual reality may involve potential risks and problems, including time wasting, titillation, addiction, and withdrawal from most things real. Why make the efforts that an encumbering, confining real world necessitates if virtual reality can provide ease, pleasure, and enhanced vividness without the downside of demands, exertions, obligations, or consequences?
I end this chapter with virtual reality because phenomenology offers singular insights as to its benefits, limitations, and experiential impacts. Phenomenological concepts like lifeworld, natural attitude, intentionality, body-subject, environmental embodiment, place, and atmosphere identify integral constituents of any human experience, whether of the past, present, or future; whether
real or virtual. Human beings are always already immersed in their worlds, even if that immersion becomes virtual. Understanding the many lived dimensions of human-immersion-in- world, including its architectural aspects, is perhaps the most central aim, responsibility, and value of phenomenology broadly and of architectural phenomenology specifically.
Bibliography
Alexander, Christopher (1964) Notes on the Synthesis of Form, Cambridge, MA: Harvard University Press. Alexander, Christopher (2002–05) The Nature of Order, 4 vols., Berkeley, CA: Center for Environmental Structure. Alexander, Christopher, Sara Ishikawa, and Murray Silverstein (1977) A Pattern Language, New York: Oxford University Press.
Bachelard, Gaston (1957/1964) The Poetics of Space, Boston: Beacon Press.
Bermudez, Julio (2015) Transcending Architecture, Washington, DC: Catholic University of America Press. Borch, Christian (ed.) (2014) Architectural Atmospheres, Basil Birkhäuser.
Bollow, Otto (1963/2011) Human Space, London: Hyphen Press.
Borgmann, Albert (1992) Crossing the Postmodern Divide, Chicago: University of Chicago Press.
Böhme, Gernot (1993) “Atmosphere as the Fundamental Concept of a New Aesthetics,” Thesis Eleven, 36, 113–
126.
Böhme, Gernot (2014) “Urban Atmospheres,” in Christian Borch (ed.) Architectural Atmospheres, Basil Birkhäuser, pp. 42–59.
Böhme, Gernot, Tinino Griffero, and Jean-Paul Thibald (eds.) (2014) Architecture and Atmosphere, Espoo, Finland: Tapio Wirkkala Rut Bryk Foundation.
Casey, Edward S. (2009) Getting Back into Place, 2nd edition, Bloomington, IN: Indiana University Press. Eliade, Mircea (1957/1961) The Sacred and the Profane. New York: Harcourt Brace.
Gehl, Jan (1987) Life between Buildings. New York: Van Nostrand Reinhold.
Griffero, Tonino (2014) “Atmospheres and Lived Space,” Studia Phaenomenologica, 14, 29–51. Griffero, Tonino (2017) Quasi-Things, Albany, NY: SUNY Press.
Hale, Jonathan (2017) Merleau-Ponty for Architects. London: Routledge. Hall, Edward (1966) The Hidden Dimension, New York: Doubleday. Harries, Karsten (1988) “Voices of Space,” Center, 4, 34–39.
Harries, Karsten (1997), The Ethical Function of Architecture, Cambridge, MA: MIT Press.
Heidegger, Martin (1952/1971) “Building Dwelling Thinking,” in Poetry, Language, Thought, Albert Hofstadter
Jacobs, Jane (1961) The Death and Life of Great American Cities, New York: Random House.
Jacobson, Kirsten (2010) “The Experience of Home and the Space of Citizenship,” The Southern Journal of
Philosophy, 48 (3), 219–245.
Janson, Alban and Florian Tigges (2014) Fundamental Concepts of Architecture: The Vocabulary of Spatial
Situations, Basel: Birkhäuser.
Kelly, Kevin (2016) The Inevitable. New York: Viking.
Lane, Belden (2000) Landscapes of the Sacred, Baltimore: Johns Hopkins Press. Leach, Neil (1997) Rethinking Architecture, London: Routledge.
Leatherbarrow, David (2002) Uncommon Ground, Cambridge, MA: MIT Press. Lynch, Kevin (1960) The Image of the City. Cambridge, MA: MIT Press.
Macarthur, John and Naomi Stead (2012) “Introduction: Architecture and Aesthetics,” in C. Greig Crysler, Stephen Cairns, and Hilde Heyman (eds.) The SAGE Handbook of Architectural Theory, London: Sage, pp. 123–135. Malgrave, Harry Francis (2013) Architecture and Embodiment, London: Routledge.
Malgrave, Harry Francis and David Goodman (2011) An Introduction to Architectural Theory, Oxford, UK: Wiley-
Blackwell.
Malpas, Jeff (1999) Place and Experience, Cambridge, UK: Cambridge University Press. Malpas, Jeff (2006) Heidegger’s Topology, Cambridge, MA: MIT Press.
Merleau-Ponty, Maurice (1962) Phenomenology of Perception, New York: Academic Press.
Moore, Charles and Kent Bloomer (1977) Body, Memory, and Architecture, New Haven, CT: Yale University Press.
Moran, Dermot (2000) Introduction to Phenomenology, London: Routledge.
Moran, Dermot (2005) Edmund Husserl: Founder of Phenomenology, Cambridge, UK: Polity.
Moran, Dermot (2011) “Edmund Husserl’s Phenomenology of Habituality and Habitus,” Journal of the British
Society for Phenomenology, 42 (1), 53–77.
Mugerauer, Robert (1994) Interpretations on Behalf of Place, Albany, NY: SUNY Press. Mugerauer, Robert (2008) Heidegger and Homecoming, Toronto: University of Toronto Press. Newman, Oscar (1973) Defensible Space, New York: Macmillan.
Norberg-Schulz, Christian (1971) Existence, Space and Architecture, New York: Rizzoli. Norberg-Schulz, Christian (1980) Genius Loci, New York: Rizzoli.
Norberg-Schulz, Christian (1985) The Concept of Dwelling, New York: Rizzoli.
Norberg-Schulz, Christian (1988) Architecture: Meaning and Place, New York: Rizzoli. Norberg-Schulz, Christian (2000a) Architecture: Presence, Language, Place, Milan: Skira.
Norberg-Schultz, Christian (2000b) Principles of Modern Architecture, London: Andreas Papadakis. Oldenberg, Ray (1999) The Great Good Place, 2nd edition, New York: Marlowe & Company.
Otero-Pailos, Jorge (2010) Architecture’s Historical Turn: Phenomenology and the Rise of the Postmodern,
Minneapolis: University of Minnesota Press.
Otero-Pailos, Jorge (2012) “Architectural Phenomenology and the Rise of the Postmodern,” in C. Greig Crysler, Stephen Cairns, and Hilde Heynen (eds.) The SAGE Handbook of Architectural Theory, London: Sage, pp. 136–151. Pallasmaa, Juhani (2005) The Eyes of the Skin, London: Wiley.
Pallasmaa, Juhani (2009) The Thinking Hand, London: Wiley.
Pallasmaa, Juhani (2014) “Space, Place, and Atmosphere,” in Christian Borch (ed.) Architectural Atmospheres,
Basil: Birkhäuser, pp. 18–41.
Pallasmaa, Juhani (2016) “Place and Atmosphere,” in Jeff Malpas (ed.) The Intelligence of Place, London: Bloomsbury, pp. 129–155.
Perella, Stephen (ed.) (1988) Form; Being; Absence: Pratt Journal of Architecture, 2.
Relph, Edward (1976) Place and Placelessness, London: Pion.
Robinson, Sarah and Juhani Pallasmaa (eds.) (2015) Mind in Architecture: Neuroscience, Embodiment, and the
Future of Design. Cambridge, MA: MIT Press.
Rush, Fred (2008) On Architecture, New York: Routledge.
Sachs, Avigail (2013) “Architects, Users and the Social Sciences in Postwar America,” in Kenny Cupers (ed.), Use
Matters, New York: Routledge, pp. 69–84.
Seamon, David (2013) “Lived Bodies, Place, and Phenomenology,” Journal of Human Rights and the Environment
4: 143–166.
Seamon David (2017) “A Phenomenological and Hermeneutic Reading of Rem Koolhaas’s Seattle Central Library,” in Ruth Conway Dalton and Christopher Hölscher (eds.), Take One Building: Interdisciplinary Research Perspectives on the Seattle Central Library, London: Routledge, pp. 67–94.
Sharr, Adam (2007) Heidegger for Architects, New York: Routledge.
Shatzki, Theodore R. (2007) Martin Heidegger: Theorist of Space, Stuttgart: Franz Steiner Verlag.
Shirazi, M. Reza (2014) Towards an Articulated Phenomenological Interpretation of Architecture, New York: Routledge.
Sommers, Robert (1969/2007) Personal Space, updated edition, Bristol, UK: Bosko Books. Thiis-Evensen, Thomas (1989) Archetypes in Architecture, Oxford: Oxford University Press. Tuan, Yi-Fu (1974) Topophilia, Englewood Cliffs, NJ: Prentice-Hall.
van Manen, Max (2014) Phenomenology of Practice, Walnut Creek, CA: Left Coast Press.
Vesely, Dalibor (2004) Architecture in the Age of Divided Representation, Cambridge, MA: MIT Press. Whyte, William (1980) The Social Life of Small Urban Spaces, New York: Project for Public Spaces. Zumthor, Peter (2006) Atmospheres, Basel: Birkhäuser.
Eko berarti lingkungan , sedangkan Arsitektur adalah, suatu bentuk atau masa. Arsitektur ekologi adalah arsitek yang membuat desain berdasarkan lingkungan sekitar karena memiliki wawasan lingkungan dan menerapkan potensi alam dengan semaksimal mungkin . Pada dasarnya arsitektur ekologi didasarkan akan sadar lingkungan dimana dari kesadaran akan lingkungan akan menciptakan bangunan yang nyaman oleh pemilik. Keselarasan antara bangunan dengan alam sekitarnya, mulai dari Atmosfer, biosfer, Lithosfer serta komunitas menghasilkan kenyaman, kemanan, keindahan serta ketertarikan.
Tujuan Bangunan yang berwawasan Lingkungan
Sebagai panutan masyarakat mengenai pentingnya studi lingkungan sebelum mendirikan bangunan Memberikan arahan bentuk bangunan yang sesuai dengan lingkungan serta budaya sekitar Memberikan contoh perletakan tapak bangunan tanpa menimbulkan pengaruh negatif terhadap lingkungan Mengikutsertakan masyarakat dalam proses pembangunan, sebagai pembelajaran serta peningkatan ekonomi lokal Memberikan contoh pengelolaan serta perawatan bangunan ekologi, Memberikan kontribusi terhadap lingkungan sekitar untuk merawat sumber material lokal,dan mengajak masyrakat untuk dapat memahami cara merawat, menggunakan serta mamanfaatkan sumber material local
Prinsip-prinsip ekologi tersebut antara lain:
Flutuation = Prinsip fluktuasi menyatakan bahwa bangunan didisain dan dirasakan sebagai tempat membedakan budaya dan hubungan proses alami. Bangunan seharusnya mencerminkan hubungan proses alami yang terjadi di lokasi dan lebih dari pada itu membiarkan suatu proses dianggap sebagai proses dan bukan sebagai penyajian dari proses, lebihnya lagi akan berhasil dalam menghubungkan orang-orang dengan kenyataan pada lokasi tersebut. Stratification = Prinsip stratifikasi menyatakan bahwa organisasi bangunan seharusnya muncul keluar dari interaksi perbedaan bagian-bagian dan tingkat-tingkat. Semacam organisasi yang membiarkan kompleksitas untuk diatur secara terpadu. Interdependence (saling ketergantungan) = Menyatakan bahwa hubungan antara bangunan dengan bagiannya adalah hubungan timbal balik. Peninjau (perancang dan pemakai) seperti halnya lokasi tidak dapat dipisahkan dari bagian bangunan, saling ketergantungan antara bangunan dan bagian-bagiannya berkelanjutan sepanjang umur bangunan. Eko arsitektur menonjolkan arsitektur yang berkualitas tinggi meskipun kualitas di bidang arsitektur sulit diukur dan ditentukan, takada garis batas yang jelas antara arsitektur yang bermutu tinggi dan arsitektur yang biasa saja. Fenomena yang ada adalah kualitas arsitektur yang hanya memperhatikan bentuk dan konstruksi gedung dan cenderung kurang memperhatikan kualitas hidup dan keinginan pemakainya, padahal mereka adalah tokoh utama yang jelas.
Dalam pandangan eko-arsitektur gedung dianggap sebagai makhluk atau organik, berarti bahwa bidang batasan antara bagian luar dan dalam gedung tersebut, yaitu dinding, lantai, dan atap dapat dimengerti sebagai kulit ketiga manusia (kulit manusia sendiri dan pakaian sebagai kulit pertama dan ke dua). Dan harus melakukan fungsi pokok yaitu bernapas, menguap, menyerap, melindungi, menyekat, dan mengatur (udara, kelembaban, kepanasan, kebisingan, kecelakaan, dan sebagainya). Oleh karena itu sangat penting untuk mengatur sistem hubungan yang dinamis antara bagian dalam dan luar gedung. Dan eko-arsitektur senantiasa menuntut agar arsitek (perencana) dan penguna gedung berada dalam satu landasan yang jelas.
Pada perkembangannya ekoarsitektur disebut juga dengan istilah greenarchitecture(arsitektur hijau) mengingat subyek arsitektur dan konteks lingkungannya bertujuan untuk meningkatkan kualitas dari hasil arsitektur dan lingkungannya. Dalam perspektif lebih luas, lingkungan yang dimaksud adalah lingkungan global alami yang meliputi unsur bumi, udara, air, dan energi yang perlu dilestarikan. Ekoarsitektur atau arsitektur hijau ini dapat disebut juga sebagai arsitektur hemat energi yaitu salah satu tipologi arsitektur yang ber-orientasi pada konservasi lingkungan global alami. standar-standar yang harus ada dalam bangunan hemat energi, yaitu: • SNI 6389:2011, Konservasi energi selubung bangunan pada bangunan gedung. • SNI 6390:2011, Konservasi energi tata udara bangunan gedung. • SNI 6197:2011, Konservasi energi pada sistem pencahayaan. • SNI 6196:2011, Prosedur audit energi pada bangunan gedung.
Contoh-contoh bangunan hemat energi Solar Dezhou China Kota Dezhou dengan perusahaan China Solar Lembah host beberapa industri yang inovatif membuat komponen untuk masa depan surya kita. Tapi produk surya mereka tidak hanya diproduksi di sini, mereka juga diterapkan di seluruh kota Dezhou.
Seorang pengunjung pertama kali Dezhou akan terkesan oleh jumlah besar kolektor surya terlihat pada atap. Dan satu akan lebih terkesan melihat bahwa jalur umum di dekat pusat kota danau menarik dan mengesankan kota diterangi oleh penerangan umum surya, menyimpan energi siang hari selama waktu malam pencahayaan dan menghilangkan stres dari grid listrik.
Pusat kongres yang mengesankan, adalah sebuah karya dari aplikasi energi surya dalam dirinya sendiri. Prinsip surya pasif, aktif surya untuk pemanasan dan aktif surya untuk listrik digabungkan dalam sebuah bangunan yang mengesankan dan elegan \
PUTRAJAYA – Pusat Energi ASEAN menganugerahkan penghargaan tertinggi ASEAN Energy Awards untuk bangunan di Malaysia, Diamond Building (Bangunan Berlian). Bangunan delapan lantai tersebut dinobatkan sebagai bangunan paling hemat energi di ASEAN. Diamond Building merupakan markas dari Komisi Energi Malaysia (Suruhanjaya Tenaga) yang berlokasi di Putrajaya. Bangunan ini memiliki desain yang pasif dan struktur hemat energi yang dirancang menggunakan cahaya alami dan mengonsumsi sepertiga energi dari bangunan konvensional seukurannya.
Bangunan yang selesai dibangun pada 2009 ini juga memperoleh peringkat Platinum dalam Indeks Bangunan Hijau Malaysia (GBI) dan program Green Mark di Singapura. Bangunan ini dinamakan berlian karena bentuknya yang unik mirip batu permata. Di bagian atas gedung ada panel surya photovoltaic (PV), yang menghasilkan sekitar 10 persen dari kebutuhan energi bangunan. Sementara sistem penampung air hujan mampu menghemat sekitar 70 hingga 80 persen dari penggunaan air di bangunan. Bentuk bangunan yang piramida terbalik memungkinkan atapnya diisi banyak panel surya dan lebih banyak ruang di tanah untuk tanaman hijau. Inti bangunan adalah pusat atrium besar yang dirancang untuk menerima dan mengatur sinar matahari menggunakan sistem roller-blind otomatis yang responsif terhadap intensitas serta sudut kejadian sinar matahari.
Masalah-masalah yang ditemukan Dalam Menerapkan Arsitektur Ekologi Teknologi yang kini semakin canggih yang berdampak merusak alam,walaupun hal ini bagus tapi jika tidak dapat ditanggulangi akan berdampak pada masa depan kehidupan manusia karena kerusakan alam. Tingkat pertumbuhan yang tinggi, pertumbuhan manusia akan terus bertambah sedangkan lingkungan semakin berkurang karena tempat yang dibutuhkan manusia Berikut Ilmu dalam mewujudkan Eko Arsitektur:
Arsitektur, perencana yang mewujudkan konsep sebelumnya yang telah diolah maksimal sehinggga layak dituangkan ke dalam disain Teknik Geologi, mengetahui kondisi struktur tanah secara teknik sipil, Teknik Mineral, mengetahui sumber air dan cara pengelolaannya Teknik sipil, mengetahui kelayakan penggunaan struktur fisik bangunan, serta perhitungannya Ahli Pertanian/Landscape/kehutanan, mengetahui jenis serta manfaat vegetasi ( penghijauan ) Ekonomi, mengontrol sistem administrasi serta keuangan secara keseluruhan
Semakin
berkembangnyateknologi komunikasisaatinitidakdapatdipukiriakibat berkembangnyakebutuhankomunikasimanusia.Sehinggasemakindibutuhkannyasuatu pembaharuan sistem untuk mensupport hal
tersebut. Hal ini yang ditawarkan oleh teknologi 4Gdibandingkandengan teknologi 3G.4Gmenawarkankecepatan3kali lebihcepatdari teknologi3G.4Gatauyanglebihdikenaldengankomunikasiwireless/mobilegenerasi keempat
ini, akan memungkinkan hal-hal seperti IP berbasis suara, data, video dan
streaming multimedia berkualitas tinggi pada perangkat portabelseperti
kecepatan transmisi data pada modem dengan menggunakan kabel. Pada
dasaranyaharapan yang ditujukan untuk teknologi 4G adalah kualitas streaming
audio/video yang berkualitas tinggi, berselancar dari dan ke IP
(InternetProtocol).Pada3G komunikasijaringan teleponseluler memberikankecepatan data maksimum 384kbps pada
download, yang biasanya sekitar 200kbps, dan 64kbps pada upload.Ini bisa
sebanding dengan koneksi broadband rumahan.Maka pada4Gkomunikasi jaringan teleponseluler iniakanmemilikikecepatantransmisidatayanglebihtinggi daripada 3G.Kecepatan transmisi data
mobile 4G direncanakan hingga 100 Mbps pada saat bergerak dan 1Gbps ketika
tidak bergerak.
PENDAHULUAN
Komunikasi
memegang peranan penting dalam kehidupan ini, setiap manusia membutuhkan
manusiayanglainbaiklangsungmaupuntidaklangsung.Kebutuhanterhadapkomunikasiini mendorongmanusiauntukterusberinovasimembuatterobosanuntukmembuatalatkomunikasi yang sederhana mungkin. Dari berbagai kebutuhan terhadap
komunikasi ini maka manusia membuat teknologi komunikasi. Salah satu teknologi
komunikasi yang trend saat ini adalah teknologi seluler 2G dan 3G (Bhalla,
2010). Saat ini berkembang 3G yang memberikan kecepatan data dan pelayan yanglebihvariasi.Namunbegitu3Gtidakmendukung videoconferencesehinggasangat dibutuhkannya pengembangan teknologi
tersebut menuju 4G. Jaringan 4G ini sangat membutuhkan semuaperangkatdigital,halitusangatberbedadenganteknologiyangtelahdiimplementasikan sekarang. Singkatnya,4Gperangkatdanlayananselulerakanmengubahkomunikasinirkabelke on-line, real-timekonektivitas.Teknologi
4G akan memungkinkan seorang individu untuk memiliki akseslangsungkelayanan lokasisecaraspesifikyangmenawarkaninformasitentangpermintaan pada kecepatan luar biasa tinggi
dan biaya rendah.
Perkembangan
Teknologi 1G, 2G, 3G, 3.5G, 4G Dan 5G
“G” pada setiap Teknologi pada1G, 2G, 3G, 3.5G, 4G Dan 5G
adalah Generasi. Teknologi sekarang sudah sangat maju dan GPRS, EDGE,
UMTS, HSDPA adalah generasinya. GPRS adalah generasi pertamanya disusul dengan
Edge dengan memberikan layanan agak cepat lalu 3G dengan menghadirkan layanan
tercepat dan akhirnya teknologi sekarang 3.5G menyingkirkan semua dengan
menghadirkan layanan sangat cepat untuk mengakses data, dan mungkin akan hadir
layanan 4G.
Perjalanan
Generasi
G berarti Generation dan berhubungan dengan kecepatan
transmisi data
1G – Original analog cellular for voice (AMPS, NMT, TACS)
14.4 kbps
2G – Digital narrowband circuit data (TDMA, CDMA) 9-14.4
kbps
3G – Digital broadband packet data (CDMA, EV-DO, UMTS, EDGE)
500-700 kbps
3.5G – Replacement for EDGE is HSPA 1-3 mbps and HSDPA up to
7.2Mbps
4G – Digital broadband packet data all IP (Wi-Fi, WIMAX,
LTE) 3-5 mbps
5G – Gigabit per second in a few years (?) 1+ gbps
Untuk memudahkan pembelajaran, disini akan dijabarkan secara
singkat definisi dari setiap kata asing yang berhubungan dengan teknologi.
·GPRS
(General Packet Radio Service) :
suatu teknologi yang digunakan untuk pengiriman dan penerimaan paket data. GPRS
sering disebut dengan teknologi 2.5G. Fasilitas yang diberikan oleh GPRS :
e-mail, mms (pesan gambar), browsing, internet. Secara teori GPRS memberikan
kecepatan akses antara 56kbps sampai 115kbps.
·EDGE
(Enhanced Data for Global Evolution) : teknologi perkembangan dari GSM, rata-rata memiliki
kecepatan 3kali dari kecepatan GPRS. Kecepatan akses EDGE secara teori sekitar
384kbps. Fasilitas yang disediakan EDGE sama seperti GPRS (e-mail, mms, dan
browsing).
·UMTS
(Universal Mobile Telecommunication Service) : perkembangan selanjutnya dari EDGE. UMTS sering disebut
generasi ke tiga (3G). Selain menyediakan fasilitas akses internet (e-mail, mms,
dan browsing), UMTS juga menyediakan fasilitas video streaming, video
conference, dan video calling*). Secara teori kecepatan akses UMTS sekitar
480kbps.
·HSDPA
(High Speed Downlink Packet Access) merupakan perkembangan akses data selanjutnya dari 3G.HSDPA
sering disebut dengan generasi 3.5 (3.5G) karena HSDPA masih berjalan pada
platform 3G. Secara teori kecepatan akses data HSDPA sama seperti 480kbps, tapi
pastinya HSDPA lebih cepat lah. Kalau gak lebih cepat apa gunanya menciptakan
HSDPA. Semakin baru tekonologi pastinya semakin bagus.
1G
1G atau Generasi Pertama(First
Generation) adalah sebuah istilah untuk menyebutkan generasi
pertama teknologi-teknologi yang digunakan pada sistem komunikasi seluler.[1] Generasi pertama atau 1G
merupakan teknologi ponsel pertama yang menggunakan sistem analog, yang umumnya dikenal dengan AMPS (Advanced Mobile Phone System)
dan TACS.[1][2][3] Teknologi ini mulai digunakan
tahun 1970 seiring penemuan mikroprosesor untuk komunikasi nirkabel.[2] Teknologi sistem analog pada 1G menggunakan Digital
Signaling.[3]Analog adalah metode yang digunakan untuk mengirimkan
informasi dalam jaringan telekomunikasi mobile tersebut.[3] Teknologi 1G hanya bisa melayani
komunikai via suara.[1][2][3] Teknologi 1G sudah tidak
digunakan lagi karena telah digantikan oleh 2G, 3G, 4G, dan 5G.[2][3]
TEKNOLOGI GENERASI PERTAMA (1G) Generasi pertama atau 1G merupakan teknologi
handphone pertama yang diperkenalkan pada era 80-an dan masih menggunakan
sistem analog. Generasi pertama ini menggunakan teknik komunikasi yang disebut
Frequency Division Multiple Access (FDMA). Teknik ini memungkinkan untuk
membagi-bagi alokasi frekuensi pada suatu sel untuk digunakan masing-masing
pelanggan di sel tersebut, sehingga setiap pelanggan saat melakukan pembicaraan
memiliki frekuensi sendiri (prinsipnya seperti pada stasiun radio dimana satu
stasiun radio hanya menggunakan satu frekuensi untuk siarannya). Kemampuan teknologi 1 G Kemampuan teknologi 1 G ini hanya dapat bisa
melayani komunikasi suara saja tidak dapat melayani komunikasi data dalam
kecepatan tinggi dan besar. Kelemahan teknologi 1 G Kapasitas trafik yang kecil, jumlah pelanggan
yang dapat ditampung dalam satu sel sedikit, penggunaan spektrum frekuensi yang
boros karena satu pengguna menggunakan satu buah kanal frekuensi, dan suara
tidak jernih.
TEKNOLOGI GENERASI KEDUA (2G)
Teknologi generasi kedua muncul karena tuntutan pasar dan kebutuhan akan
kualitas yang semakin baik. Generasi 2G sudah menggunakan teknologi digital. Generasi
ini menggunakan mekanisme Time Division Multiple Access (TDMA) dan Code
Division Multiple Access (CDMA) dalam teknik komunikasinya. Kemampuan teknologi 2G
Generasi kedua selain digunakan untuk komunikasi suara, juga bisa untuk SMS
(Short Message Service adalah layanan dua arah untuk mengirim pesan pendek
sebanyak 160 karakter), voice mail, call waiting, dan transfer data dengan
kecepatan maksimal 9.600 bps (bit per second). Kelebihan 2G dibanding 1G selain
layanan yang lebih baik, dari segi kapasitas juga lebih besar. suara yang
dihasilkan menjadi lebih jernih, karena berbasis digital, maka sebelum dikirim
sinyal suara analog diubah menjadi sinyal digital. Tenaga yang diperlukan untuk
sinyal sedikit sehingga dapat menghemat baterai, sehingga handset dapat dipakai
lebih lama dan ukuran baterai bisa lebih kecil. Kelemahan teknologi 2 G
Kecepatan transfer data masih rendah, tidak efisien untuk trafik rendah,
jangkauan jaringan masih terbatas dan sangat tergantung oleh adanya BTS (cell
Tower).
4.TEKNOLOGI GENERASI DUA SETENGAH (2.5G)
Teknologi 2.5G merupakan peningkatan dari teknologi 2G terutama dalam platform
dasar GSM telah mengalami penyempurnaan, khususnya untuk aplikasi data. Untuk
yang berbasis GSM teknologi 2.5G di implementasikan dalam GPRS (General Packet
Radio Services) dan WiDEN, sedangkan yang berbasis CDMA diimplementasikan dalam
CDMA2000 1x.
5.TEKNOLOGI GENERASI KETIGA (3G)
Teknologi generasi ketiga (3G Third Generation) dikembangkan oleh suatu
kelompok yang diakui para ahli dan pelaku bisnis yang berkompeten dalam bidang
teknologi wireless di dunia. 3G (Third Generation) sebagai teknologi yang
berfungsi mempunyai kecepatan transfer data sebesar 144 kbps pada kecepatan
user 100 km/jam, mempunyai kecepatan transfer data sebesar 384 kbps pada kecepatan
berjalan kaki, mempunyai kecepatan transfer data sebesar 2 Mbps pada untuk user
diam (stasioner). Kemampuan teknologi 3G :
Memiliki kecepatan transfer data cepat (144kbps-2Mbps) sehingga dapat melayani
layanan data broadband seperti internet, video on demand, music on demand,
games on demand, dan on demand lain yang memungkinkan kita dapat memilih
program musik, video, atau game semudah memilih channel di TV. Kecepatan
setinggi itu juga mampu melayani video conference dan video streaming lainnya. Kelebihan 3G dari generasi-genersi sebelumnya :
Kualitas suara yang lebih bagus, keamanan yang terjamin, kecepatan data
mencapai 2 Mbps untuk lokal/Indoor/slow-moving access dan 384 kbps untuk wide
area access, support beberapa koneksi secara simultan, sebagai contoh, pengguna
dapat browse internet bersamaan dengan melakukan call (telepon) ke tujuan yang
berbeda, infrastruktur bersama dapat mensupport banyak operator dilokasi yang
sama. Interkoneksi ke other mobile dan fixed users, roaming nasional dan internasional,
bisa menangani packet-and circuit-switched service termasuk internet (IP) dan
videoconferencing. Juga high data rate communication services dan asymmetric
data transmission, efiensi spektrum yang bagus, sehingga dapat menggunakan
secara maksimum bandwidth yang terbatas, support untuk multiple cell layer,
co-existance and interconnection dengan satellite-based services, mekanisme
billing yang baru tergantung dari volume data, kualitas service dan waktu.
Kelemahan Teknologi 3G
Memerlukan Kontrol Daya “Ideal” dan belum mencukupinya kecepatan transfer data
dalam melayani layanan multimedia yang memerlukan kecepatan yang mumpuni.
6.TEKNOLOGI GENERASI TIGA SETENGAH (3.5G)
Teknologi 3.5 G atau disebut juga super 3G merupakan peningkatan dari teknologi
3G, terutama dalam peningkatan kecepatan transfer data yang lebih dari
teknologi 3G (>2 Mbps) sehingga dapat melayani komunikasi multimedia seperti
akses internet dan video sharing.
7.TEKNOLOGI GENERASI KEEMPAT (4G- FOURTH GENERATION)
Teknologi fourth generation (4G) adalah teknologi yang baru memasuki tahap uji
coba. Salah satunya oleh Jepang dimana pihak NTT DoCoMo, perusahaan ponsel di
Jepang, memanfaatkan tenaga hingga 900 orang insinyur ahli untuk mewujudkan
teknologi generasi ke 4. Motivasi Teknologi 4G
Mendukung service multimedia Interaktif, telekonfrensi, Wireless Intenet,
bandwidth yang lebar, bit rates lebih besar dari 3G, global mobility, Service
Portability, Low-cost service, dan skalabilitas untuk jaringan mobile. Teknologi yang baru dalam 4G
Sepenuhnya untuk jaringan packet-switched, semua komponen jaringan digital,
bandwidth yang besar untuk mendukung multimedia service dengan biaya yang murah
( Sampai 100 Mbps), dan jaringan keamanan data yang kuat. Teknologi yang digunakan :
Untuk teknologi 4G, kemungkinan teknologi yang diadaptasi adalah :
MIMO-OFDM (Multi Input Multi Output – Orthogonal Frequency Modulation). OFDM
merupakan suatu teknik transmisi multi carrier (banyak frekuensi). Dimana tiap
frekuensi adalah orthogonal satu sama lain, sehingga terjadinya overlapping
tidak akan menyebabkan interferensi. Dan di sisi lain teknik MIMO dapat membuat
kanal paralel independen dalam spatial domain untuk mengirimkan data stream
yang beragam. Teknik MIMO bisa memperbesar kapasitas kanal tanpa mengurangi
bandwidth yang ada. Jumlah antena yang dipergunakan pada bagian pemancar 2
sedangkan pada bagian penerima 4. MIMO dapat mencapai kecepatan transfer data
sampai 59,52 Mb.